.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yww

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii. To be Published
    Site RSGI
    PDB Id 2yww Target Id mja001001406.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13381, Molecular Weight 16906.33 Da.
    Residues 149 Isoelectric Point 9.27
    Sequence mipmeelkvkkitngtvidhidagkalmvfkvlnvpketsvmiainvpskkkgkkdilkiegielkked vdkislispdvtiniirngkvveklkpqipdeiegtlkctnpncitnkekvrgkfkiesknplkircyy cekflnevife
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.226
    Matthews' coefficent 2.50 Rfactor 0.226
    Waters 166 Solvent Content 50.75

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 4
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch