.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yx0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an archaeal TYW1, the enzyme catalyzing the second step of wye-base biosynthesis. Acta Crystallogr.,Sect.D 63 1059-1068 2007
    Site RSGI
    PDB Id 2yx0 Target Id pho001001705.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14003, Molecular Weight 39838.42 Da.
    Residues 342 Isoelectric Point 8.38
    Sequence mmemitikpgkitvqanpnmpkevaelfrkqhyeivgrhsgvklchwlkksltegrfcykqkfygihsh rclqmtpvlawcthncifcwrpmenflgtelpqpwddpafiveesikaqrklligykgnpkvdkkkfee awnpthaaislsgepmlypymgdlveefhkrgfttfivtngtiperleemikedklptqlyvsitapdi etynsvnipmipdgwerilrflelmrdlptrtvvrltlvkgenmhspekyaklilkarpmfveakaymf vgysrnrltinnmpshqdirefaealvkhlpgyhiedeyepsrvvlimrddvdpqgtgvegrfikh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.21 Rfree 0.242
    Matthews' coefficent 2.46 Rfactor 0.194
    Waters 113 Solvent Content 49.97

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch