The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Methanocaldococcus jannaschii PurS, One of the Subunits of Formylglycinamide Ribonucleotide Amidotransferase in the Purine Biosynthetic Pathway. To be Published
    Site RSGI
    PDB Id 2yx5 Target Id mja001001593.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13384, Molecular Weight 9695.97 Da.
    Residues 83 Isoelectric Point 5.91
    Sequence mykatviiklkkgvlnpegrtiqralnflgfnnvkevqtykmidiimegeneekvkeeveemckkllan pvihdyeikvekie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.284
    Matthews' coefficent 3.32 Rfactor 0.24
    Waters 11 Solvent Content 62.97

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch