.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yx6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH0822. To be Published
    Site RSGI
    PDB Id 2yx6 Target Id pho001000822.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13944, Molecular Weight 13666.91 Da.
    Residues 121 Isoelectric Point 6.08
    Sequence mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfeehgpgdlpnfikdhgakivlt ygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwkekiekeh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.26242
    Matthews' coefficent 1.95 Rfactor 0.21419
    Waters 107 Solvent Content 37.05

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch