.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yx8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the human receptor activity-modifying protein 1 extracellular domain. Protein Sci. 17 1907-1914 2008
    Site RSGI
    PDB Id 2yx8 Target Id hso002001341.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12978, Molecular Weight 10051.97 Da.
    Residues 86 Isoelectric Point 6.11
    Sequence cqeanygallrelcltqfqvdmeavgetlwcdwgrtirsyreladctwhmaeklgcfwpnaevdrffla vhgryfrscpisgravr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.281
    Matthews' coefficent 1.88 Rfactor 0.221
    Waters 17 Solvent Content 31.16

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch