.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yxb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the methylmalonyl-CoA mutase alpha-subunit from Aeropyrum pernix. To be Published
    Site RSGI
    PDB Id 2yxb Target Id ape001001686.2
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12108, Molecular Weight 17967.97 Da.
    Residues 163 Isoelectric Point 8.03
    Sequence mymsslqstrervlgtprrrykvlvakmgldghdrgakvvaralrdagfevvytglrqtpeqvamaavq edvdvigvsilngahlhlmkrlmaklrelgaddipvvlggtipipdleplrslgireiflpgtslgeii ekvrklaeekrmreeaeaseqvgqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.24713
    Matthews' coefficent 1.66 Rfactor 0.21194
    Waters 79 Solvent Content 26.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch