The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Cobalamin biosynthesis precorrin 8W decarboxylase (cbiT). To be Published
    Site RSGI
    PDB Id 2yxd Target Id mja001000391.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13371, Molecular Weight 20500.96 Da.
    Residues 183 Isoelectric Point 9.01
    Sequence mkymipdeefirregvpitkeeiravsigklnlnkddvvvdvgcgsggmtveiakrckfvyaidyldga ievtkqnlakfnikncqiikgraedvldklefnkafiggtkniekiieildkkkinhivantivlenaa kiinefesrgynvdavnvfisyakkipsghmflaknpitiikavr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.27322
    Matthews' coefficent 2.13 Rfactor 0.19793
    Waters 108 Solvent Content 42.36

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch