.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yxe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of L-isoaspartyl protein carboxyl methyltranferase. To be Published
    Site RSGI
    PDB Id 2yxe Target Id mja001000172.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13367, Molecular Weight 23759.61 Da.
    Residues 215 Isoelectric Point 5.41
    Sequence mdleeqkkaviekliregyikskrvidallkvpreeflpehlkeyayvdtpleigygqtisaihmvgmm celldlkpgmkvleigtgcgyhaavtaeivgedglvvsieripelaekaertlrklgydnvivivgdgt lgyeplapydriyttaagpkipeplirqlkdggkllmpvgrylqrlvlaekrgdeiiikdcgpvafvpl vgkegfqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.23143
    Matthews' coefficent 3.29 Rfactor 0.19182
    Waters 202 Solvent Content 62.61

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch