.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yxg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of dihydrodipicolinate synthase from Methanocaldococcus jannaschii. Acta Crystallogr.,Sect.F 65 1222-1226 2009
    Site RSGI
    PDB Id 2yxg Target Id mja001000244.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13369, Molecular Weight 31577.84 Da.
    Residues 289 Isoelectric Point 5.08
    Sequence mfkgvypaiitpfknkevdfdgleeninfliengvsgivavgttgesptlsheehkkviekvvdvvngr vqviagagsncteeaielsvfaedvgadavlsitpyynkptqeglrkhfgkvaesinlpivlynvpsrt avnlepktvkllaeeysnisavkeanpnlsqvselihdakitvlsgndeltlpiialggkgvisvvani vpkefvemvnyalegdfekareihyklfplmkamfietnpipvktalnmmgrpagelrlplcemseehk kilenvlkdlgli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.22444
    Matthews' coefficent 2.37 Rfactor 0.15774
    Waters 700 Solvent Content 48.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch