.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yxh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mazG-related protein from Thermotoga maritima. To be Published
    Site RSGI
    PDB Id 2yxh Target Id tma001000360.2
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14073, Molecular Weight 13572.99 Da.
    Residues 116 Isoelectric Point 4.91
    Sequence mverlleiierslrkcpwlekqsietllealaseieevaeavkkndlanleeeigdliydallvaavaq rdygidlesaiqkvvekishrkpwlfweekisleeaekiwkerkkki
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.26312
    Matthews' coefficent 2.39 Rfactor 0.21205
    Waters 229 Solvent Content 48.48

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch