.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yxm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of I-set domain of human Myosin Binding ProteinC. To be Published
    Site RSGI
    PDB Id 2yxm Target Id hso002000567.8
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12926, Molecular Weight 10083.00 Da.
    Residues 87 Isoelectric Point 6.81
    Sequence aafakildpayqvdkggrvrfvveladpklevkwykngqeirpstkyifehkgcqrilfinncqmtdds eyyvtagdekcstelfvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.51 Rfree 0.212
    Matthews' coefficent 2.41 Rfactor 0.196
    Waters 126 Solvent Content 48.92

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch