.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yxs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Sturcture of N-terminal domain of human galectin-8 with D-lactose. To be Published
    Site RSGI
    PDB Id 2yxs Target Id hso002002300.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13006, Molecular Weight 17040.89 Da.
    Residues 151 Isoelectric Point 8.44
    Sequence mmlslnnlqniiynpvipyvgtipdqldpgtlivicghvpsdadrfqvdlqngssvkpradvafhfnpr fkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyghrigpekidtl giygkvnihsigf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.13 Rfree 0.234
    Matthews' coefficent 2.22 Rfactor 0.19
    Waters 152 Solvent Content 44.62

    Ligand Information
    Ligands LAT (BETA-LACTOSE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch