The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title crystal structure of c-Myc-1 binding protein domain from Homo sapiens. To be Published
    Site RSGI
    PDB Id 2yy0 Target Id hsi002003381.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12350, Molecular Weight 6107.69 Da.
    Residues 53 Isoelectric Point 5.34
    Sequence nsaldflkhhlgaatpenpeiellrlelaemkekyeaiveenkklkaklaqye
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.289
    Matthews' coefficent 2.72 Rfactor 0.244
    Waters 45 Solvent Content 54.86

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch