.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yy5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of tryptophanyl-tRNA synthetase from Mycoplasma pneumoniae. To be Published
    Site RSGI
    PDB Id 2yy5 Target Id my_001000005.2
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS13666, Molecular Weight 39077.38 Da.
    Residues 346 Isoelectric Point 9.55
    Sequence mmkraltgiqasgkqhlgnylgvmqslielqeqcqlfvfvadlhsitvdfqpqalkqnnfdlvrtllav gldpqkaclflqsdllehsmmgylmmvqsnlgelqrmtqfkakkaeqtrnpngtlniptglltypalma gdillyqpdivpvgndqkqhleltrdlaqriqkkfklklrlpqfvqnkdtnrimdlfdptkkmsksskn qngviylddpkevvvkkirqattdsfnkirfapktqpgvtnmltilkallkepvnqsltnqlgndleay fstksyldlknalteatvnllvniqrkreqisreqvfnclqagknqaqatarttlalfydgfglgsqnik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.55 Rfree 0.251
    Matthews' coefficent 2.82 Rfactor 0.192
    Waters 491 Solvent Content 56.36

    Ligand Information
    Ligands SO4 (SULFATE) x 8;WSA (5'-O-[(L-TRYPTOPHYLAMINO)SULFONYL]ADENOSINE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch