.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yy9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of BTB domain from mouse HKR3. To be Published
    Site RSGI
    PDB Id 2yy9 Target Id mmi002017035.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13399, Molecular Weight 13243.37 Da.
    Residues 122 Isoelectric Point 6.05
    Sequence hsvrvlqelnkqrekgqycdatldvgglvfkahwsvlaccshffqriygdgtggsvvlpagfaeifgll ldffytghlaltsgnrdqvllaakelrvpeavelcqsfqpqtsvgqaqsglgq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.289
    Matthews' coefficent 2.52 Rfactor 0.226
    Waters 64 Solvent Content 51.22

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch