.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yyb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the conserved hypothetical protein TTHA1606 from Thermus thermophilus HB8. Proteins 76 244-248 2009
    Site RSGI
    PDB Id 2yyb Target Id ttk003001839.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14806, Molecular Weight 26830.29 Da.
    Residues 242 Isoelectric Point 5.67
    Sequence mdrdelvryldaylriqdfpqdpslnglqvegkrtvrkvgaavdageaifrkaleeevdflivhhglfw gkpfpivghhkrrletlfqgginlyaahlpldaheevgnnfvlarelglvdltpwdvgvkgrfpqptpl lqvadrlgqltgmqplvhqggldhvetvilvsgsgtgllpkvdadlfvtgepkhsvfhetferglnviy aghydtetfgvkalaahlearfglpwvfldhptgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.283
    Matthews' coefficent 3.86 Rfactor 0.239
    Waters 20 Solvent Content 68.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch