.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yyh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Nudix family protein from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2yyh Target Id aae001001449.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12066, Molecular Weight 15639.36 Da.
    Residues 139 Isoelectric Point 5.95
    Sequence mgfnvktpllatdviirlwdgenfkgivlierkyppvglalpggfvevgerveeaaaremreetglevr lhklmgvysdperdprahvvsvvwigdaqgepkagsdakkvkvyrleeipldklvfdhkkiildflkgny
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.248
    Matthews' coefficent 2.07 Rfactor 0.211
    Waters 522 Solvent Content 40.54

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch