The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal sturcture of human bromodomain protein. To be Published
    Site RSGI
    PDB Id 2yyn Target Id hsk003001125.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12838, Molecular Weight 14475.06 Da.
    Residues 122 Isoelectric Point 6.80
    Sequence kkkteglvkltpidkrkcerlllflychemslafqdpvpltvpdyykiiknpmdlstikkrlqedysmy skpedfvadfrlifqncaefnepdsevanagiklenyfeellknlypekrfpk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.285
    Matthews' coefficent 2.51 Rfactor 0.239
    Waters 99 Solvent Content 50.96

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch