.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yyr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of PHD domain of Pygopus complexed with trimethylated histone H3 peptide. To be Published
    Site RSGI
    PDB Id 2yyr Target Id mmt007007653.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13504, Molecular Weight 8488.01 Da.
    Residues 77 Isoelectric Point 4.61
    Sequence hghsssdpvypcgictnevnddqdailceascqkwfhrictgmtetayglltaeasavwgcdtcmadkd vqlmrtre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.234
    Matthews' coefficent 2.71 Rfactor 0.213
    Waters 60 Solvent Content 54.68

    Ligand Information
    Ligands ALA-ARG-THR-M3L-GLN-THR (N-TRIMETHYLLYSINE) x 1
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch