.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yyu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Geobacillus kaustophilus. To be Published
    Site RSGI
    PDB Id 2yyu Target Id gka001001155.2
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12300, Molecular Weight 26943.44 Da.
    Residues 246 Isoelectric Point 7.28
    Sequence ghmhtpfivaldfpskqeverflrpfagtplfvkvgmelyyqegpaivaflkeqghavfldlklhdipn tvkqamkglarvgadlvnvhaaggrrmmeaaiegldagtpsgrmrprciavtqltstdermlheelwis rplvetvahyaalakesgldgvvcsaneaafikercgasflavtpgirfaddaahdqvrvvtprkaral gsdyivigrsltraadplrtyarlqhewnggeresttpt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.272
    Matthews' coefficent 2.02 Rfactor 0.214
    Waters 169 Solvent Content 39.07

    Ligand Information
    Ligands C5P (CYTIDINE-5'-MONOPHOSPHATE) x 2
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch