.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yyy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of glyceraldehyde-3-phosphate dehydrogenase from the archaeal hyperthermophile Methanocaldococcus jannaschii. Acta Crystallogr.,Sect.F 65 1227-1233 2009
    Site RSGI
    PDB Id 2yyy Target Id mja001001146.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13378, Molecular Weight 38099.84 Da.
    Residues 343 Isoelectric Point 5.19
    Sequence mpakvlingygsigkrvadavsmqddmevigvtktkpdfearlavekgyklfvaipdnervklfedagi pvegtildiiedadivvdgapkkigkqnleniykphkvkailqggekakdvednfnalwsynrcygkdy vrvvscnttglcrilyainsiadikkarivlvrraadpnddktgpvnaitpnpvtvpshhgpdvvsvvp efegkiltsavivpttlmhmhtlmvevdgdvsrddileaikktpriitvraedgfsstakiieygrdlg rlrydinelvvweesinvleneiflmqavhqesivipenidciramlqmeednfksiektnkamgiq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.19795
    Matthews' coefficent 2.46 Rfactor 0.16923
    Waters 348 Solvent Content 50.03

    Ligand Information
    Ligands NAP (NADP) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch