.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yyz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Sugar ABC transporter, ATP-binding protein. To be Published
    Site RSGI
    PDB Id 2yyz Target Id tma001000421.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14074, Molecular Weight 40384.93 Da.
    Residues 359 Isoelectric Point 8.31
    Sequence mpsirvvnlkkyfgkvkavdgvsfevkdgefvallgpsgcgktttllmlagiykptsgeiyfddvlvnd ippkyrevgmvfqnyalyphmtvfeniafplrarriskdevekrvveiarkllidnlldrkptqlsggq qqrvalaralvkqpkvllfdeplsnldanlrmimraeikhlqqelgitsvyvthdqaeamtmasriavf nqgklvqygtpdevydspknmfvasfignpptnflrdfsvsvenkqtilkrddviiklpepvdvklkev vvgirpehcrisrervensipgvvyvveplgrdiivnvktekgeiikvfgdtgkapqpgenvflvpdlr kihlfnpeteetil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.11 Rfree 0.27973
    Matthews' coefficent 2.55 Rfactor 0.22322
    Waters 276 Solvent Content 51.82

    Pathway

    Reactions found in Metabolic Reconstruction for TM0421

    Name: inositol transport in via ABC transport
    Other genes that carryout this rxn:TM0420 TM0418 TM0419
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + inost[e] --> adp[c] + h[c] + inost[c] + pi[c]

     

    Ligand Information
    Ligands SO4 (SULFATE) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch