.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yz2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the ABC transporter in the cobalt transport system. To be Published
    Site RSGI
    PDB Id 2yz2 Target Id tma001000222.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14071, Molecular Weight 30231.41 Da.
    Residues 266 Isoelectric Point 5.55
    Sequence mrievvnvshifhrgtplekkalenvslvinegecllvagntgsgkstllqivaglieptsgdvlydge rkkgyeirrnigiafqypedqffaervfdevafavknfypdrdpvplvkkamefvgldfdsfkdrvpff lsggekrrvaiasvivhepdilildeplvgldregktdllrivekwktlgktvilishdietvinhvdr vvvlekgkkvfdgtrmeflekydprfftskmlvmrrlvlkgedpfsmsddellervcns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.29403
    Matthews' coefficent 2.81 Rfactor 0.21352
    Waters 476 Solvent Content 56.25

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch