The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Monofunctional Histidinol Phosphate Phosphatase from Thermus thermophilus HB8. Biochemistry 46 12618-12627 2007
    Site RSGI
    PDB Id 2yz5 Target Id ttk003000063.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14212, Molecular Weight 29974.50 Da.
    Residues 267 Isoelectric Point 5.62
    Sequence mvdshvhtplcghaeghpeayleearakglkgvvftdhspmppwydpesrmrlealpfyllalervrer aqdlyvgigleadfhpgtegflaqllrrypfdyvigsvhylgawpldhpdhqeeyawrdlkevfrayfq evekaarsglfhaighldlpkkfghrlpeeallelaepalravaeaglfldvntaglrrpakevypapa llrrarelgiglvlgsdahrpeevgfafpevqallaglgfreayyfvegspvayplsras
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.232
    Matthews' coefficent 2.53 Rfactor 0.195
    Waters 306 Solvent Content 51.33

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;GOL (GLYCEROL) x 1
    Metals ZN (ZINC) x 2;FE (FE) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch