The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dCTP deaminase from Sulfolobus tokodaii. To be Published
    Site RSGI
    PDB Id 2yzj Target Id sto001001632.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14054, Molecular Weight 18975.04 Da.
    Residues 169 Isoelectric Point 8.75
    Sequence ghmkglteklmilshqsiknllgkvilnyseenvrengydlricgdkyyelvqgaelpekkatlreief kerailsanhtylfesceefnmpadlavlitlkstlarngflapptvidagykgkvnvaitavynsslk kgmathhliflkldkpterlyngkyqggili
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.66 Rfree 0.227
    Matthews' coefficent 2.22 Rfactor 0.208
    Waters 299 Solvent Content 44.51

    Ligand Information
    Metals MG (MAGNESIUM) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch