.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with ADP from Methanocaldococcus jannaschii. To be Published
    Site RSGI
    PDB Id 2yzl Target Id mja001001592.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13382, Molecular Weight 27759.69 Da.
    Residues 242 Isoelectric Point 5.20
    Sequence meikleeilkkqplysgkaksiyeidddkvliefrdditagngakhdvkqgkgylnalissklfealee ngvkthyikyieprymiakkveiipievivrniaagslcrrypfeegkelpfpivqfdykndeygdpml nediavalglatreelnkikeialkvnevlkklfdekgiilvdfkieigkdregnllvadeispdtmrl wdketrdvldkdvfrkdlgdviakyrivaerlgll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.248
    Matthews' coefficent 2.60 Rfactor 0.228
    Waters 127 Solvent Content 52.61

    Ligand Information
    Ligands SO4 (SULFATE) x 2;ADP (ADENOSINE-5'-DIPHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch