.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of D-Alanine:D-Alanine Ligase with substrate from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2yzm Target Id ttk003001114.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14523, Molecular Weight 34664.07 Da.
    Residues 319 Isoelectric Point 4.97
    Sequence mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaapegehpfpppl swerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlskrvlaqagvpvvpwvavrk geppvvpfdppffvkpantgssvgisrverfqdleaalalafrydekavvekalspvrelevgvlgnvf geaspvgevryeapfydyetkytpgraellipapldpgtqetvqelalkaykvlgvrgmarvdfflaeg elylnelntipgftptsmyprlfeaggvaypellrrlvelalt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.21 Rfree 0.266
    Matthews' coefficent 2.98 Rfactor 0.224
    Waters 266 Solvent Content 58.76

    Ligand Information
    Ligands DAL (D-ALANINE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch