.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of D-alanine:D-Alanine Ligase with AMPPNP from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2yzn Target Id ttk003001114.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14524, Molecular Weight 34664.07 Da.
    Residues 319 Isoelectric Point 4.97
    Sequence mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaapegehpfpppl swerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlskrvlaqagvpvvpwvavrk geppvvpfdppffvkpantgssvgisrverfqdleaalalafrydekavvekalspvrelevgvlgnvf geaspvgevryeapfydyetkytpgraellipapldpgtqetvqelalkaykvlgvrgmarvdfflaeg elylnelntipgftptsmyprlfeaggvaypellrrlvelalt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.60 Rfree 0.280
    Matthews' coefficent 3.07 Rfactor 0.23
    Waters 81 Solvent Content 59.95

    Ligand Information
    Ligands ANP (PHOSPHOAMINOPHOSPHONIC) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch