.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of pyridoxine biosynthesis protein from Methanocaldococcus jannaschii. to be published
    Site RSGI
    PDB Id 2yzr Target Id mja001000677.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13374, Molecular Weight 35854.58 Da.
    Residues 330 Isoelectric Point 5.09
    Sequence mkkgtdllkkgfakmvkhgvvmdvtnveqaqiaeeagavavmalervpadiraaggvarmsdpalieei mdavsipvmakcrighttealvleaigvdmidesevltqadpffhiykkkfnvpfvcgarnlgeavrri wegaamirtkgeagtgniveavrhmrlmneaiaqlqrmtdeevygvakfyanryaelaktvregmglpa tvlenepiyegftlaeiidglyevllevkklgrlpvvnfaaggvatpadaalmmqlgsdgvfvgsgifk senpleraraiveatynydkpdivaevsknlgeamkgiditqiseaekmqyrgd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.225
    Matthews' coefficent 3.64 Rfactor 0.197
    Waters 318 Solvent Content 66.25

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 9

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch