.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2yzs Target Id aae001000369.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12036, Molecular Weight 36884.82 Da.
    Residues 316 Isoelectric Point 8.90
    Sequence mgrvyyinshgtlsrhentlrfenaevkkdipvedveeifvfaelslntkllnflaskgiplhffnyyg yytgtfypressvsghllikqvehyldaqkrlylaksfvigsilnleyvykisadtylnkvketnsipe lmsveaefrklcykkleevtgwelekrtkrppqnplnalisfgnsltyakvlgeiyktqlnptvsylhe pstkrfslsldvaevfkpifvdnliirliqenkidkthfstelnmtflneigrkvflkafnellettif ypklnrkvshrtliklelyklikhlleeevylplnygglk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.254
    Matthews' coefficent 2.98 Rfactor 0.219
    Waters 265 Solvent Content 58.79

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch