.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title ADP-ribosylglycohydrolase-related protein complex. To be Published
    Site RSGI
    PDB Id 2yzw Target Id ttp001001059.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14835, Molecular Weight 32910.62 Da.
    Residues 303 Isoelectric Point 6.35
    Sequence mkglkerqdrrlgaflglavgdalgaqveglpkgtfpevremkgggphrlppgfwtddtsqalclaesl lqrgfdpkdqmdrylrwyregyrsatgvcfglghatrraleryaatgdpyagdeagagngplmrlaplv layenhpdllslarraartthgarealeatevlawllrealrgapkeallalepfrgadlhpalrrvve ggfweapeegpgyapgtlaaalwafargrdfeegmrlavnlggdadtvgavygqlagayyglgaipgrw lralhlreemealalalyrmsmaspre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.214
    Matthews' coefficent 1.95 Rfactor 0.186
    Waters 203 Solvent Content 36.82

    Ligand Information
    Ligands
    Metals GD3 (GADOLINIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch