.
The Open Protein Structure Annotation Network
PDB Keyword
.

2yzy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2yzy Target Id ttk003001415.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14720, Molecular Weight 24074.80 Da.
    Residues 214 Isoelectric Point 9.49
    Sequence mrklaaflglvgllslglaqsaqeildrveknlstpwqatvqgriqgpggeeellarvyalpqarlfrv eflkpgslegnftvitekevwnylyltnqlvisprekakiqglgfapqglgdlkalseqvdlrlegevr lpegmawklvgrskenqgfaamelyilkadprplrfvfldekgkvladlkvvefkrtnlteaqlkrypk daqvvrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.251
    Matthews' coefficent 2.17 Rfactor 0.229
    Waters 141 Solvent Content 43.21

    Ligand Information
    Ligands MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch