The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dihydroorotase from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2z00 Target Id ttk003000118.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14228, Molecular Weight 45691.04 Da.
    Residues 426 Isoelectric Point 5.86
    Sequence milirnvrlvdargergpadvligegrilsleggeakqvvdgtgcflapgfldlhahlrepgeevkedl fsgllaavrggytdlvsmpntkppvdtpeavralkekakalglarlhpaaaltekqegktltpagllre agavlltddgrtnedagvlaagllmaaplglpvavhaedaglrrngvmndgpladllglpgnppeaeaa riardlevlryalrrspatprlhvqhlstkrglelvreakraglpvtaeatphhltlteealrtfdplf kvapplrgeedrealleglldgtldaiatdhaphtlaekekdllrapfgipslevafpllytelhlkrg fplqrlvelftdgprrvlglpplhleegaeaslvllspkerpvdpsafaskaryspwagwvlggwpvlt lvagrivhealk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.42 Rfree 0.192
    Matthews' coefficent 5.57 Rfactor 0.188
    Waters 393 Solvent Content 77.90

    Ligand Information
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch