The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphoribosylaminoimidazole synthetase from Geobacillus kaustophilus. To be Published
    Site RSGI
    PDB Id 2z01 Target Id gka001000265.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12290, Molecular Weight 37007.77 Da.
    Residues 348 Isoelectric Point 4.87
    Sequence ghmakaykqagvdieagyqavalmkehvqktmrpevlggiggfgglfdlsalgyrqpvlisgtdgvgtk lklaflldrhdtigidcvamcvndiivqgaeplffldyiacgkavpekiaaivkgvadgcveagcalig getaempgmydedeydlagfavgvaekerlitgetiqagdalvglpssglhsngyslvrrivfeqakls ldeiyepldvplgeellkptriyakllrsvrerftikgmahitggglieniprmlppgigariqlgswp ilpifdflrekgsleeeemfsvfnmgiglvlavspetaaplvewlsergepayiigevakgagvsfagggra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.258
    Matthews' coefficent 2.32 Rfactor 0.226
    Waters 63 Solvent Content 47.06

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch