.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z04

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphoribosylaminoimidazole carboxylase ATPase subunit from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2z04 Target Id aae001000245.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12029, Molecular Weight 41985.74 Da.
    Residues 365 Isoelectric Point 8.35
    Sequence mltvgilgggqlgwmtilegrklgfkfhvledkenapacrvadrcfrtgqisefvdscdiityefehik devlekcesklipnpqalyvkksrireklflkkhgfpvpeflvikrdeiidalksfklpvvikaeklgy dgkgqyrikkledanqvvknhdkeesfiieefvkfeaeiscigvrdregktyfypqpfnkheegiliyn yvpyaklkeaeeitkrlmelldivgvftveffllkdgrvlinefaprvhntghwtldgaytsqfenllr aitemplgstelklpsgmvnilgksyeeiplkeilsvegaklywygkekkprrkvghvnvvgrskeevv ekvervftllkgsreklpap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.267
    Matthews' coefficent 2.19 Rfactor 0.232
    Waters 40 Solvent Content 43.88

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch