The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2z06 Target Id ttk003001657.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14765, Molecular Weight 27985.46 Da.
    Residues 252 Isoelectric Point 5.73
    Sequence mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdlvslgnhawd hkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdplddpfraldrlleeekad yvlvevhaeatsekmalahyldgrasavlgththvptldatrlpkgtlyqtdvgmtgtyhsiiggevet flarfltgrpqpfraaqgkarfhatelvfeggrpvaispyvweep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.246
    Matthews' coefficent 2.19 Rfactor 0.232
    Waters 361 Solvent Content 43.79

    Ligand Information
    Metals CO (COBALT) x 13



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch