.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z08

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2z08 Target Id ttk003001817.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14800, Molecular Weight 14756.15 Da.
    Residues 137 Isoelectric Point 5.27
    Sequence mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrleraegvleea raltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsqsqrvvaeapcpvllvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.245
    Matthews' coefficent 1.86 Rfactor 0.201
    Waters 105 Solvent Content 34.00

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch