.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of RNA-binding domain of NS1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1). To be Published
    Site RSGI
    PDB Id 2z0a Target Id ar_001000438.1
    Molecular Characteristics
    Source Influenza a virus
    Alias Ids TPS12158, Molecular Weight 8311.95 Da.
    Residues 72 Isoelectric Point 5.80
    Sequence mdpntvssfqvdcflwhvrkrladqelgdapfldrlrrdqkslrgrgntlgldietatragkqiveril eee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.85 Rfree 0.23828
    Matthews' coefficent 1.89 Rfactor 0.17247
    Waters 286 Solvent Content 34.95

    Ligand Information
    Ligands GLY (SUCCINIC) x 4;SIN x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch