The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of CBM20 domain of human putative glycerophosphodiester phosphodiesterase 5 (KIAA1434). To be Published
    Site RSGI
    PDB Id 2z0b Target Id hsk002101406.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12764, Molecular Weight 13012.16 Da.
    Residues 118 Isoelectric Point 5.09
    Sequence psqvafeirgtllpgevfaicgscdalgnwnpqnavallpendtgesmlwkativlsrgvsvqyryfkg yflepktiggpcqvivhkwethlqprsitpleseiiiddgqfgihngve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.243
    Matthews' coefficent 3.26 Rfactor 0.221
    Waters 448 Solvent Content 62.32

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch