.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of PII protein. To be Published
    Site RSGI
    PDB Id 2z0g Target Id aae001000109.5
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12024, Molecular Weight 12495.98 Da.
    Residues 112 Isoelectric Point 5.51
    Sequence mkkieaiikpfkldevkdalveigiggmtvtevkgfgqqkghteiyrgteyvidflpkvkievvvrded vekvvetivktaqtgrvgdgkifiipvedvirirtgergeqai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.23
    Matthews' coefficent 1.76 Rfactor 0.186
    Waters 139 Solvent Content 30.21

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 10
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch