.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Epstein-Barr virus DNA polymerase processivity factor BMRF1. J.Biol.Chem. 284 35896-35905 2009
    Site RSGI
    PDB Id 2z0l Target Id ar_001000239.1
    Molecular Characteristics
    Source Human herpesvirus 4
    Alias Ids TPS12134, Molecular Weight 33473.33 Da.
    Residues 314 Isoelectric Point 6.39
    Sequence mettqtlrfktkalavlskcydhaqthlkggvlqvnllsvnyggprlaavanagtaglisfevspdava ewqnhqspeeapaavsfrnlaygrtcvlgkelfgsaveqaslqfykrpqggsrpefvkltmeyddkvsk shhtcalmpymppasdrlrneqmigqvllmpktasslqkwarqqgsggvkvtlnpdlyvttytsgeacl tldykplsvgpyeaftgpvakaqdvgaveahvvcsvaadslaaalslcripavsvpilrfyrsgiiavv aglltsagdlpldlsvilfnhaseeaaastasepedks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.90 Rfree 0.251
    Matthews' coefficent 4.10 Rfactor 0.206
    Waters 121 Solvent Content 70.03

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 9

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch