.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical ATP-dependent RNA helicase from Sulfolobus tokodaii. To be Published
    Site RSGI
    PDB Id 2z0m Target Id sto001002459.2
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14063, Molecular Weight 38340.51 Da.
    Residues 337 Isoelectric Point 9.27
    Sequence mnekieqairemgfknftevqsktiplmlqgknvvvraktgsgktaayaipilelgmkslvvtptrelt rqvashirdigrymdtkvaevyggmpykaqinrvrnadivvatpgrlldlwskgvidlssfeiviidea dlmfemgfiddikiilaqtsnrkitglfsatipeeirkvvkdfitnyeeieaciglanvehkfvhvkdd wrskvqalrenkdkgvivfvrtrnrvaklvrlfdnaielrgdlpqsvrnrnidafregeydmlittdva srgldiplvekvinfdapqdlrtyihrigrtgrmgrkgeaitfilneywlekevkkvsqka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.229
    Matthews' coefficent 2.81 Rfactor 0.205
    Waters 270 Solvent Content 56.27

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch