The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of APPL1-BAR domain. To be Published
    Site RSGI
    PDB Id 2z0n Target Id hso003007272.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13104, Molecular Weight 31696.28 Da.
    Residues 275 Isoelectric Point 4.93
    Sequence mpgidklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltskllkeye kqrfplggddevmsstlqqfskvidelsschavlstqladammfpitqfkerdlkeiltlkevfqiasn dhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfcalntlqykkkiallepllgymqaq isffkmgsenlneqleeflanigtsvqnvrremdsdietmqqtiedlevasdplyvpdpdptkfpvnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.259
    Matthews' coefficent 1.96 Rfactor 0.209
    Waters 96 Solvent Content 37.32

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch