.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH domain of Bruton's tyrosine kinase. To be Published
    Site RSGI
    PDB Id 2z0p Target Id hso003004528.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13051, Molecular Weight 19952.01 Da.
    Residues 169 Isoelectric Point 9.04
    Sequence aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidvekitcvetvvpe knppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelrkrwihqlknvirynsdlv qkyhpcfwidgqylccsqtaknamgcqilen
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.58 Rfree 0.3
    Matthews' coefficent 2.71 Rfactor 0.242
    Waters 68 Solvent Content 54.64

    Ligand Information
    Ligands 4PT ((2R)-3-{[(S)-{[(2S,3R,5S,6S)-2,6-DIHYDROXY-3,4,5-) x 4
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch