The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of DH-PH domain of RhoGEF3(Xpln). To be Published
    Site RSGI
    PDB Id 2z0q Target Id mmt010006564.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13664, Molecular Weight 39208.65 Da.
    Residues 339 Isoelectric Point 6.17
    Sequence cvnqvltakeikrqeaifelsqgeedliedlklakkayhdpmlklsimteqelnqifgtldsliplhee llsqlrdvrkpdgstehvgpilvgwlpclssydsycsnqvaakalldhkkqdhrvqdflqrclespfsr kldlwnfldiprsrlvkyplllreilrhtpndnpdqqhleeainiiqgivaeintktgesecryykerl lyleegqkdslidssrvlcchgelknnrgvklhvflfqevlvitravthneqlcyqlyrqpipvkdltl edlqdgevrlggslrgafsnnervknffrvsfkngsqsqthslqandtfnkqqwlncirqake
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.79 Rfree 0.243
    Matthews' coefficent 2.34 Rfactor 0.203
    Waters 360 Solvent Content 47.35

    Ligand Information
    Ligands SO4 (SULFATE) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch