.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein TTHA0547. to be published
    Site RSGI
    PDB Id 2z0r Target Id ttk003002111.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14826, Molecular Weight 11501.61 Da.
    Residues 103 Isoelectric Point 5.92
    Sequence mapdlsgtwyvlegdpgehlvvealgerlsgiwtsrelaeaflahhphlgmrvsalesralkeaylral gmlqveavmvdyrpgthraqvarvkdlleevrra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.30 Rfree 0.278
    Matthews' coefficent 2.29 Rfactor 0.229
    Waters 286 Solvent Content 46.26

    Ligand Information
    Ligands SO4 (SULFATE) x 8
    Metals CL (CHLORIDE) x 11

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch