.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative exosome complex RNA-binding protein. To be Published
    Site RSGI
    PDB Id 2z0s Target Id ape001001448.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12105, Molecular Weight 26059.16 Da.
    Residues 235 Isoelectric Point 8.75
    Sequence msserqlagrivvpgeplpeeveasppyvidykgvkratvvgllrekgdgggrafvklkeiyvpqagdv vigliqsvgimnwfvdinspyvavlsvqdflgrpfnpavddmqsllkvgdyikakvvafdktrsplltv qgeglgrivrgkiveispakvprvigrkmsmlktleekteckifvarngrihlecpnedleaiavmaik iideeaytsgltkriikfieeerrirev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.20 Rfree 0.331
    Matthews' coefficent 3.58 Rfactor 0.277
    Waters Solvent Content 65.67

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch