.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein PH0355. To be Published
    Site RSGI
    PDB Id 2z0t Target Id pho001000355.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13814, Molecular Weight 12795.37 Da.
    Residues 109 Isoelectric Point 7.80
    Sequence mkwemglqeeyielikagkkkiegrlydekrrqikpgdiiifeggklkvkvkgirvyssfkemlekegi envlpgvksieegvkvyrqfydeerekkygvvaieiepie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.21
    Matthews' coefficent 2.37 Rfactor 0.178
    Waters 606 Solvent Content 48.07

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch