.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z0w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the 2nd CAP-Gly domain in human Restin-like protein 2 reveals a swapped-dimer. To be Published
    Site RSGI
    PDB Id 2z0w Target Id hss001000330.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13193, Molecular Weight 9193.89 Da.
    Residues 83 Isoelectric Point 6.87
    Sequence egelrlgervlvvgqrlgtirffgttnfapgywygielekphgkndgsvggvqyfscsprygifappsr vqrvtdsldtlsei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.246
    Matthews' coefficent 2.38 Rfactor 0.225
    Waters 15 Solvent Content 48.38

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch