.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z13

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal DUF1126 in human EF-hand domain. To be Published
    Site RSGI
    PDB Id 2z13 Target Id hsi002022525.4
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12549, Molecular Weight 14315.45 Da.
    Residues 120 Isoelectric Point 5.67
    Sequence wvafdkqvlsfdayleeevldksqtnyriryykiyfypeddtiqvnepevknsgllqgtsirrhritlp ppdedqfytvyhfnvgtevvfygrtfkiydcdaftrnflrkigvkvnppvq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.84 Rfree 0.227
    Matthews' coefficent 1.98 Rfactor 0.181
    Waters 172 Solvent Content 37.97

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch